PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010529103.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB
Protein Properties Length: 1559aa    MW: 172821 Da    PI: 6.8828
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010529103.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.43.8e-09829870346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +W  eE e+++d  +++G++ +++Ia+++   +t  +c+++++k
   XP_010529103.1 829 PWGSEEREIFLDKLAMYGKD-FRKIASHLE-QKTTADCIDFYYK 870
                      8*****************99.*********.9**********98 PP

2Myb_DNA-binding25.43.4e-0810421084347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                        WT eE   + +++ ++G++ ++ I++++g +R+  qck ++ k+
   XP_010529103.1 1042 HWTDEERSAFMQGFLLYGKN-FAMISQCIG-TRSQDQCKVFFSKV 1084
                       5*****************99.*********.********998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.16E-13813873IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-5821871IPR009057Homeodomain-like
PROSITE profilePS5129316.153825876IPR017884SANT domain
SMARTSM007174.8E-8826874IPR001005SANT/Myb domain
PfamPF002495.0E-7829870IPR001005SANT/Myb domain
CDDcd001673.80E-6829871No hitNo description
PROSITE profilePS5129311.07210381089IPR017884SANT domain
SMARTSM007173.5E-610391087IPR001005SANT/Myb domain
SuperFamilySSF466891.87E-1010421089IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-510421083IPR009057Homeodomain-like
PfamPF002491.1E-510421083IPR001005SANT/Myb domain
CDDcd001671.00E-410431084No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1559 aa     Download sequence    Send to blast
MPQDHASWDR KDLLRHRKHE RLAQSFDSSF RWRNSSSVSS SHHVPREFSR WDPGDVRRPH  60
GHGKQGGRHQ FASETDHGHV SSRSSTRIFE DDNYRPSASR GDWRYNKNTR DGRVSFNQKE  120
WKHHTWEMNN GSTRILGRLP DMNNDCLSAD ERPSNASDSR TAISKLSVLA HPTQQNIEIS  180
PVKTPTGNWD QNFSNQRLAS PSHPHSVSGS LYELSYLLDK HDNEVCSSGR QCHDVRGDNT  240
SLCPSNFHVD LQLTHGQLLS KDQKDDKVHG VNGIHIVEKL GKESCLGSIN WKHPLWTHSG  300
RFASRGFGFS HSSSSKSFGA VDTIEQKTEV LPKIVSVTES TSRDAASYFT SSCLPEETNS  360
RKKPRLGWGE GLAKYEKKKV DVNLCEDGNT MLANSTGEAY SLLCKSPTMV NASDFGSPAT  420
PSSVACSSSP GTRDKPSCMA AKAVSDASNL CRSPSPVFNY QLERIPFNLE DAGNISMENL  480
SCLLSELLRT DDSGPGDSCS IQWNVMNKVL AWKVDVLKVL ELTESEIDLL ENKRRALKFE  540
AGSLCPYQIG PVEQGAPCVA ERPEGAVHNA VPAKVSVDAT GEGVERSQDT VDIPSIKTAT  600
SSTDVDMSSF AIGSTTINDD TVQLSSGCCS IASEEDVSVI LVSNRKFAHE ASEVFNMLLP  660
RQYSWSNDTR CSTMCQDEVD PHIKQTIAVK RRIMRVKEKI LVLQFKAFQL SWKRDMHQLA  720
ISKYNAKSHK KCESNLYIKN GAIQKLPQSV RLKFYSPAPG RESPPPTAEF LNFMGKLLLG  780
FQHKRCRDIL RMPAMILGEK EKVISRFISS NGLIEDPCAV EKERAMINPW GSEEREIFLD  840
KLAMYGKDFR KIASHLEQKT TADCIDFYYK NHKSDCFVKI KKKLANGKER KCNFMLAPRK  900
KWKREMGAAS LDILGAVSVI AGNASKVTST RQMSSKRITP GGSRCLHHSD NSSEGCFYNF  960
DLHDKQTISA DGLSGGDGSL STGLISSCLR SSADPEERCR KYPKFDSTLK ISQLSHATHC  1020
DNSSDEDDTC SEESFEETSP VHWTDEERSA FMQGFLLYGK NFAMISQCIG TRSQDQCKVF  1080
FSKVRKCLGL ELIQLQSGNA STSASVDNSN EGGGSEMEVP CALEGSSVMC NDDLCAKMDV  1140
NLPNLPFNVN RDGADHLGSV KLKSDLDRSE QENGSACLGW KDGVEVVDTN ASPVHMDCSD  1200
SVPKTVESQC PAVEKTESDQ LLCTETNQGV LVSAVVSPQP PSSNATVLAN LILKSFTERL  1260
REYSDSVKET ANGTRDPPLI PAEAASSSGF SLPECLHHVP IEMCVEGVHL PQENSSSHSE  1320
TGSPNAFDVH VMERHNLDAR FFSNAHLSFG EKHQFYGQNS LQDVHVSNTT EASRIPWSSF  1380
MQDPSLNKRS KSDVIVTTTL GTGEDFSLNR CSSLTSNSTS AKQRRLSQKE SRTVNTRRHS  1440
RSLSDTERPY KNEDLRLFGT IVTSHENERN THHLHESIRQ DLQNVPIASY GIWDGNRIRT  1500
GFTALQYPEA FAVQDVSSTS EVQVGSSREI QPDGLSVYTR RKLNGSTEIP VFGTQIDGD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-14787877493NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-14787877493NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010529103.10.0PREDICTED: uncharacterized protein LOC104806084 isoform X1
TrEMBLR0HEB90.0R0HEB9_9BRAS; Uncharacterized protein
STRINGscaffold_502292.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein